| Catalog Code: | H00065057-M01A |
| Product Type: | Primary Antibody |
| Product Name: | ACD Antibody |
| List Price: | 295 |
| Clonality: | Monoclonal |
| Gene ID: | 65057 |
| Host: | Mouse |
| Clone: | 1C11-1A7 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-ACD - adrenocortical dysplasia homolog (mouse) (1C11-1A7) |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Background: | This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I. |
| Alternate Names: | anti-24432 antibody, anti-PTOP antibody, anti-Pip1 antibody, anti-TINT1 antibody |
| Immunogen: | ACD (AAH16904, 1 a.a. ~ 545 a.a) full-length recombinant protein with GST tag. |
| Epitope: | MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Preservative: | No Preservative |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| PackageSize: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, , Western Blot 1:500 |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |