ExactAntigen

ACD Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00065057-M01A
Product Type:Primary Antibody
Product Name:ACD Antibody
List Price:295
Clonality:Monoclonal
Gene ID:65057
Host:Mouse
Clone:1C11-1A7
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-ACD - adrenocortical dysplasia homolog (mouse) (1C11-1A7)
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I.
Alternate Names:anti-24432 antibody, anti-PTOP antibody, anti-Pip1 antibody, anti-TINT1 antibody
Immunogen:ACD (AAH16904, 1 a.a. ~ 545 a.a) full-length recombinant protein with GST tag.
Epitope:MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Packaging:0.1 mg IgG purified Mouse ascites.
PackageSize:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, , Western Blot 1:500
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human ACD antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about