ExactAntigen

Mouse Polyclonal anti-FLJ13912 - hypothetical protein FLJ13912, MaxPab Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00064785-B01
ProductName:FLJ13912 Antibody
Product Description:Mouse Polyclonal anti-FLJ13912 - hypothetical protein FLJ13912, MaxPab Antibody
Clonality:Polyclonal
Immunogen:FLJ13912 (AAH05879, 1 a.a. ~ 217 a.a) full-length human protein.
Epitope:MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYSEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ProteinTarget:hypothetical protein FLJ13912
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:64785
Gene_Symbol:FLJ13912
see all human GINS3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about