| CatalogCode: | H00064756-A01 |
| ProductName: | ATPAF1 Antibody |
| Product Description: | Mouse Polyclonal anti-ATPAF1 |
| Clonality: | Polyclonal |
| Immunogen: | ATPAF1 (NP_073582, 219 a.a. ~ 329 a.a) partial recombinant protein with GST tag. |
| Epitope: | LHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT* ... |
| Specificity: | ATPAF1 - ATP synthase mitochondrial F1 complex assembly factor 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ATP11 antibody, anti-ATP11p antibody, anti-FLJ22351 antibody |
| ProteinTarget: | ATPAF1 - ATP synthase mitochondrial F1 complex assembly factor 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 64756 |
| Gene_Symbol: | ATPAF1 |
| Omim_ID: | 608917, |