ExactAntigen

Mouse Monoclonal anti-ACBD3 (2G2)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00064746-M01
ProductName:ACBD3 Antibody
Product Description:Mouse Monoclonal anti-ACBD3 (2G2)
Clone:2G2
Clonality:Monoclonal
Immunogen:ACBD3 (NP_073572, 73 a.a. ~ 172 a.a) partial recombinant protein with GST tag.
Epitope:RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL* ...
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background:The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:protein A purified
Host_Name:Mouse
Buffer:1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-acyl-Coenzyme A binding domain containing 3 antibody
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:64746
Gene_Symbol:ACBD3
Omim_ID:606809,
see all human PAP7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about