| CatalogCode: | H00064746-A01 |
| ProductName: | acyl-Coenzyme A binding domain containing 3 Antibody |
| Product Description: | Mouse Polyclonal anti-acyl-Coenzyme A binding domain containing 3 |
| Clonality: | Polyclonal |
| Immunogen: | ACBD3 (NP_073572, 73 a.a. ~ 172 a.a) partial recombinant protein with GST tag. |
| Epitope: | RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL* ... |
| Specificity: | acyl-Coenzyme A binding domain containing 3 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera Other applications have not been tested. |
| Background: | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GCP60 antibody, anti-GOCAP1 antibody, anti-GOLPH1 antibody, anti-PAP7 antibody |
| ProteinTarget: | acyl-Coenzyme A binding domain containing 3 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 64746 |
| Gene_Symbol: | ACBD3 |
| Omim_ID: | 606809, |
order or more information: | company product webpage |
| request information: | |