ExactAntigen

Mouse Monoclonal anti-ATG3 autophagy related 3 homolog (1F7)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00064422-M06
ProductName:ATG3 autophagy related 3 homolog Antibody
Product Description:Mouse Monoclonal anti-ATG3 autophagy related 3 homolog (1F7)
Clone:1F7
Clonality:Monoclonal
Immunogen:ATG3 (NP_071933, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE* ...
Specificity:ATG3 autophagy related 3 homolog (S. cerevisiae)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host_Name:Mouse
Buffer:1X PBS pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-APG3 antibody, anti-APG3L antibody, anti-DKFZp564M1178 antibody, anti-FLJ22125 antibody, anti-MGC15201 antibody, anti-PC3-96 antibody
ProteinTarget:ATG3 autophagy related 3 homolog (S. cerevisiae)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:64422
Gene_Symbol:ATG3
Omim_ID:609606,
see all human Apg3p antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about