| CatalogCode: | H00064422-A01 |
| ProductName: | APG3L Antibody |
| Product Description: | Mouse Polyclonal anti-APG3L |
| Clonality: | Polyclonal |
| Immunogen: | APG3L (NP_071933, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE* ... |
| Specificity: | ATG3 - APG3 autophagy 3-like (S. cerevisiae) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-APG3 antibody, anti-DKFZp564M1178 antibody, anti-FLJ22125 antibody, anti-MGC15201 antibody, anti-PC3-96 antibody |
| ProteinTarget: | ATG3 - APG3 autophagy 3-like (S. cerevisiae) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 64422 |
| Gene_Symbol: | ATG3 |
order or
more information: | company product webpage |
| request information: |
|