| CatalogCode: | H00064324-A01 |
| ProductName: | NSD1 Antibody |
| Product Description: | Mouse Polyclonal anti-NSD1 |
| Clonality: | Polyclonal |
| Immunogen: | NSD1 (NP_071900, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQT* ... |
| Specificity: | NSD1 - nuclear receptor binding SET domain protein 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene encodes a protein containing a SET domain, 2 LXXLL motifs, 3 nuclear translocation signals (NLSs), 4 plant homeodomain (PHD) finger regions, and a proline-rich region. The encoded protein enhances androgen receptor (AR) transactivation, and this enhancement can be increased further in the presence of other androgen receptor associated coregulators. This protein may act as a nucleus-localized, basic transcriptional factor and also as a bifunctional transcriptional regulator. Mutations of this gene have been associated with Sotos syndrome and Weaver syndrome. One version of childhood acute myeloid leukemia is the result of a cryptic translocation with the breakpoints occurring within nuclear receptor-binding Su-var, enhancer of zeste, and trithorax domain protein 1 on chromosome 5 and nucleoporin, 98-kd on chromosome 11. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-NSD1 antibody, anti-NSD-1 antibody, anti-nuclear receptor binding SET domain protein 1 antibody, anti-ARA267 antibody, anti-ARA-267 antibody, anti-androgen receptor-associated coregulator 267 antibody, anti-STO antibody, anti-SOTOS antibody, anti-Sotos syndrome antibody, anti-FLJ22263 antibody |
| ProteinTarget: | NSD1 - nuclear receptor binding SET domain protein 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 64324 |
| Gene_Symbol: | NSD1 |
| Omim_ID: | 117550 130650 277590 601626 606681 |