ExactAntigen

SAMSN1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00064092-M01
Product Type:Primary Antibody
Product Name:SAMSN1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:64092
Host:Mouse
Clone:1B8
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-SAMSN1 (1B8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = SAMSN1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-SAMSN1 antibody, anti-HACS1 antibody, anti-SAM domain antibody, anti-SH3 domain and nuclear localisation signals antibody, anti-1 antibody, anti-SH3-SAM adaptor protein antibody, anti-hematopoietic adaptor containing SH3 and SAM domains 1 antibody
Immunogen:SAMSN1 (AAH29112, 1 a.a. ~ 374 a.a) full length recombinant protein with GST tag.
Epitope:MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHL ...
Specificity:SAMSN1 - SAM domain, SH3 domain and nuclear localisation signals, 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SAMSN1
Omim ID:607978
see all human HACS1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about