| CatalogCode: | H00060489-A01 |
| ProductName: | APOBEC3G Antibody |
| Product Description: | Mouse Polyclonal anti-APOBEC3G |
| Clonality: | Polyclonal |
| Immunogen: | APOBEC3G (NP_068594, 80 a.a. ~ 182 a.a) partial recombinant protein with GST tag. |
| Epitope: | LHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKY* ... |
| Specificity: | APOBEC3G - apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ARP9 antibody, anti-CEM15 antibody, anti-FLJ12740 antibody, anti-MDS019 antibody, anti-OTTHUMP00000028911 antibody, anti-bK150C2.7 antibody, anti-dJ494G10.1 antibody |
| ProteinTarget: | APOBEC3G - apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 60489 |
| Gene_Symbol: | APOBEC3G |
| Omim_ID: | 607113 H00060489-M01 |
order or more information: | company product webpage |
| request information: | |