| CatalogCode: | | H00059307-M01 |
| ProductName: | | SIGIRR Antibody |
| Product Description: | | Mouse Monoclonal anti-SIGIRR (3H8-2G3) |
| Clone: | | 3H8-2G3 |
| Clonality: | | Monoclonal |
| Immunogen: | | SIGIRR (AAH03591, 1 a.a. ~ 411 a.a) full length recombinant protein with GST tag. |
| Epitope: | | MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRR ... |
| Specificity: | | SIGIRR - single Ig IL-1R-related molecule |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgM kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ProteinTarget: | | SIGIRR - single Ig IL-1R-related molecule |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 59307 |
| Gene_Symbol: | | SIGIRR |
| Omim_ID: | | 605478 H00059307-B01 |
| more information: | | company product webpage |