ExactAntigen

JAM2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00058494-M01
Product Type:Primary Antibody
Product Name:JAM2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:58494
Host:Mouse
Clone:1G4
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-JAM2 (1G4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = JAM2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-C21orf43 antibody, anti-JAM-B antibody, anti-PRO245 antibody, anti-VE-JAM antibody, anti-VEJAM antibody
Immunogen:JAM2 (AAH17779, 29 a.a. ~ 299 a.a) full length recombinant protein with GST tag.
Epitope:FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKAT ...
Specificity:JAM2 - junctional adhesion molecule 2
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:JAM2
Omim ID:606870
see all human JAM2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about