ExactAntigen

NGB Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00058157-A01
Product Type:Primary Antibody
Product Name:NGB Antibody
List Price:205
Clonality:Polyclonal
Gene ID:58157
Host:Mouse
Product Description:Mouse Polyclonal anti-NGB
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing
Immunogen:NGB (AAH32509, 1 a.a. ~ 152 a.a) full length recombinant protein with GST tag.
Epitope:MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE* ...
Specificity:NGB - neuroglobin
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NGB
Omim ID:605304
see all human neuroglobin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about