| CatalogCode: | | H00057804-M01A |
| ProductName: | | POLD4 Antibody |
| Product Description: | | Mouse Monoclonal anti-POLD4 (2B11) |
| Clone: | | 2B11 |
| Clonality: | | Monoclonal |
| Immunogen: | | POLD4 (AAH01334, 1 a.a. ~ 35 a.a) full length recombinant protein with GST tag. |
| Epitope: | | MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL* |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM] |
| ProductRef: | | Zhang S, Lee MY et al.. A novel DNA damage response: Rapid degradation of the p12 subunit of DNA polymerase delta. J Biol Chem. 2007 May 25;282(21):15330-40. Epub 2007 Feb 21. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2b kappa |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-POLDS antibody, anti-p12 antibody |
| ProteinTarget: | | polymerase (DNA-directed), delta 4 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 57804 |
| Gene_Symbol: | | POLD4 |
| more information: | | company product webpage |