| CatalogCode: | H00057733-A01 |
| ProductName: | GBA3 Antibody |
| Product Description: | Mouse Polyclonal anti-GBA3 |
| Clonality: | Polyclonal |
| Immunogen: | GBA3 (NP_066024, 402 a.a. ~ 469 a.a) partial recombinant protein with GST tag. |
| Epitope: | KAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAH* ... |
| Specificity: | GBA3 - glucosidase, beta, acid 3 (cytosolic) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | GBA3, or cytosolic beta-glucosidase (EC 3.2.1.21), is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside, but not any known physiologic beta-glycoside, suggesting that it may be involved in detoxification of plant glycosides (de Graaf et al., 2001 [PubMed 11389701]). GBA3 also has significant neutral glycosylceramidase activity (EC 3.2.1.62), suggesting that it may be involved in a nonlysosomal catabolic pathway of glucosylceramide metabolism (Hayashi et al., 2007 [PubMed 17595169]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CBGL1 antibody, anti-GLUC antibody |
| ProteinTarget: | GBA3 - glucosidase, beta, acid 3 (cytosolic) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 57733 |
| Gene_Symbol: | GBA3 |
| Omim_ID: | 606619 H00057733-B01 |
order or
more information: | company product webpage |
| request information: |
|