ExactAntigen

Mouse Monoclonal anti-VPS18 (2G10)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00057617-M02
ProductName:VPS18 Antibody
Product Description:Mouse Monoclonal anti-VPS18 (2G10)
Clone:2G10
Clonality:Monoclonal
Immunogen:VPS18 (NP_065908, 3 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps18 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG3 Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-vacuolar protein sorting protein 18 antibody, anti-KIAA1475 antibody
ProteinTarget:vacuolar protein sorting protein 18
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:57617
Gene_Symbol:VPS18
Omim_ID:608551,
see all human VPS18 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about