| CatalogCode: | H00057617-M02 |
| ProductName: | VPS18 Antibody |
| Product Description: | Mouse Monoclonal anti-VPS18 (2G10) |
| Clone: | 2G10 |
| Clonality: | Monoclonal |
| Immunogen: | VPS18 (NP_065908, 3 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps18 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-vacuolar protein sorting protein 18 antibody, anti-KIAA1475 antibody |
| ProteinTarget: | vacuolar protein sorting protein 18 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 57617 |
| Gene_Symbol: | VPS18 |
| Omim_ID: | 608551, |