| CatalogCode: | H00057492-M01 |
| ProductName: | ARID1B Antibody |
| Product Description: | Mouse Monoclonal anti-ARID1B (2D2) |
| Clone: | 2D2 |
| Clonality: | Monoclonal |
| Immunogen: | ARID1B (NP_059989, 1364 a.a. ~ 1461 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR* ... |
| Specificity: | ARID1B - AT rich interactive domain 1B (SWI1-like) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P |
| SpeciesSummary: | Hu |
| ALTnames: | anti-6A3-5 antibody, anti-BAF250b antibody, anti-DAN15 antibody, anti-ELD/OSA1 antibody, anti-KIAA1235 antibody, anti-p250R antibody |
| ProteinTarget: | ARID1B - AT rich interactive domain 1B (SWI1-like) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 57492 |
| Gene_Symbol: | ARID1B |