ExactAntigen

family with sequence similarity 62 (C2 domain containing) member B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00057488-M02
Product Type:Primary Antibody
Product Name:family with sequence similarity 62 (C2 domain containing) member B Antibody
List Price:275
Clonality:Monoclonal
Gene ID:57488
Host:Mouse
Clone:4C3
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-family with sequence similarity 62 (C2 domain containing) member B (4C3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Genbank acession number is BC013957. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-CHR2SYT antibody, anti-KIAA1228 antibody
Immunogen:FAM62B (AAH13957, 1 a.a. ~ 359 a.a) full length recombinant protein with GST tag.
Epitope:MSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRLRQLENGTTLGQSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSE ...
Specificity:family with sequence similarity 62 (C2 domain containing) member B
Purity:IgG purified
Buffer:1X PBS pH 7.2
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:FAM62B
see all human FAM62B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about