| CatalogCode: | H00057410-A01 |
| ProductName: | SCY1-like 1 Antibody |
| Product Description: | Mouse Polyclonal anti-SCY1-like 1 |
| Clonality: | Polyclonal |
| Immunogen: | SCYL1 (AAH09967, 373 a.a. ~ 472 a.a) partial recombinant protein with GST tag. |
| Epitope: | DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP ... |
| Specificity: | SCY1-like 1 (S. cerevisiae) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | This gene encodes a transcriptional regulator belonging to the SCY1-like family of kinase-like proteins. The protein has a divergent N-terminal kinase domain that is thought to be catalytically inactive, and can bind specific DNA sequences through its C-terminal domain. It activates transcription of the telomerase reverse transcriptase and DNA polymerase beta genes. The protein has been localized to the nucleus, and also to the cytoplasm and centrosomes during mitosis. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GKLP antibody, anti-HT019 antibody, anti-NKTL antibody, anti-NTKL antibody, anti-P105 antibody, anti-TAPK antibody, anti-TEIF antibody, anti-TRAP antibody |
| ProteinTarget: | SCY1-like 1 (S. cerevisiae) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 57410 |
| Gene_Symbol: | SCYL1 |
| Omim_ID: | 607982, |
order or
more information: | company product webpage |
| request information: |
|