ExactAntigen

SALL4 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00057167-M03
Product Type:Primary Antibody
Product Name:SALL4 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:57167
Host:Mouse
Clone:6E3
Product Description:Mouse Monoclonal anti-SALL4 (6E3)
Species Summary:Hu
Background:Sal-like genes encode putative zinc finger transcription factors. For background information on SALL genes, see SALL1 (MIM 602218).
Alternate Names:anti-sal-like 4 (Drosophila) antibody
Immunogen:SALL4 (NP_065169, 954 a.a. ~ 1054 a.a) partial recombinant protein with GST tag.
Epitope:PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS* ...
Purity:protein A purified
Buffer:1x PBS, pH 7.2
Packaging:0.1 mg protein A purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SALL4
Omim ID:607323, 607343,
see all human SALL4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about