| Catalog Code: | H00057167-M03 |
| Product Type: | Primary Antibody |
| Product Name: | SALL4 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 57167 |
| Host: | Mouse |
| Clone: | 6E3 |
| Product Description: | Mouse Monoclonal anti-SALL4 (6E3) |
| Species Summary: | Hu |
| Background: | Sal-like genes encode putative zinc finger transcription factors. For background information on SALL genes, see SALL1 (MIM 602218). |
| Alternate Names: | anti-sal-like 4 (Drosophila) antibody |
| Immunogen: | SALL4 (NP_065169, 954 a.a. ~ 1054 a.a) partial recombinant protein with GST tag. |
| Epitope: | PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS* ... |
| Purity: | protein A purified |
| Buffer: | 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg protein A purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | SALL4 |
| Omim ID: | 607323, 607343, |