| CatalogCode: | H00057152-M06 |
| ProductName: | SLURP1 Antibody |
| Product Description: | Mouse Monoclonal anti-SLURP1 (4D1) |
| Clone: | 4D1 |
| Clonality: | Monoclonal |
| Immunogen: | SLURP1 (NP_065160, 25 a.a. ~ 103 a.a) partial recombinant protein with GST tag. |
| Epitope: | CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE* ... |
| Specificity: | SLURP1 - secreted LY6/PLAUR domain containing 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ANUP antibody, anti-ARS antibody, anti-ArsB antibody, anti-LY6LS antibody, anti-MDM antibody |
| ProteinTarget: | SLURP1 - secreted LY6/PLAUR domain containing 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 57152 |
| Gene_Symbol: | SLURP1 |
| Omim_ID: | 248300, 606119, |
order or
more information: | company product webpage |
| request information: |
|