ExactAntigen

Mouse Monoclonal anti-SPIRE1 (4C5)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00056907-M01
ProductName:SPIRE1 Antibody
Product Description:Mouse Monoclonal anti-SPIRE1 (4C5)
Clone:4C5
Clonality:Monoclonal
Immunogen:SPIRE1 (NP_064533, 482 a.a. ~ 584 a.a) partial recombinant protein with GST tag.
Epitope:SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI* ...
Specificity:SPIRE1 - spire homolog 1 (Drosophila)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:Spire proteins, such as SPIRE1, are highly conserved between species. They belong to the family of Wiskott-Aldrich homology region-2 (WH2) proteins, which are involved in actin organization (Kerkhoff et al., 2001 [PubMed 11747823]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
NovusRef:1. Thom SR, Bhopale VM, Mancini DJ, Milovanova TN. Actin S-Nitrosylation Inhibits Neutrophil {beta}2 Integrin Function. J Biol Chem. April 18, 2008;283(16):10822-34.
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-Spir-1 antibody
ProteinTarget:SPIRE1 - spire homolog 1 (Drosophila)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:56907
Gene_Symbol:SPIRE1
Omim_ID:609216,
see all human SPIRE1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about