ExactAntigen

Mouse Monoclonal anti-IFNK (1B7) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00056832-M01
ProductName: IFNK Antibody
Product Description: Mouse Monoclonal anti-IFNK (1B7)
Clone: 1B7
Clonality: Monoclonal
Immunogen: IFNK (NP_064509, 35 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Epitope: VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCL* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-RP11-27J8.1 antibody
ProteinTarget: IFNK
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 56832
Gene_Symbol: IFNK
more information: company product webpage
Also see:
see all human IFNK antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about