ExactAntigen

IFNK Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00056832-A01
Product Type:Primary Antibody
Product Name:IFNK Antibody
List Price:205
Clonality:Polyclonal
Gene ID:56832
Host:Mouse
Product Description:Mouse Polyclonal anti-IFNK
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on
Alternate Names:anti-RP11-27J8.1 antibody
Immunogen:IFNK (NP_064509, 35 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Epitope:VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCL* ...
Specificity:Mouse polyclonal antibody raised against a partial recombinant IFNK.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:IFNK
see all human IFNK antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about