| CatalogCode: | H00056731-M01 |
| ProductName: | SLC2A4RG Antibody |
| Product Description: | Mouse Monoclonal anti-SLC2A4RG (5D2) |
| Clone: | 5D2 |
| Clonality: | Monoclonal |
| Immunogen: | SLC2A4RG (NP_064446, 178 a.a. ~ 270 a.a) partial recombinant protein with GST tag. |
| Epitope: | EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASM* ... |
| Specificity: | SLC2A4RG - SLC2A4 regulator |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GEF antibody, anti-HDBP1 antibody, anti-Si-1-2 antibody |
| ProteinTarget: | SLC2A4RG - SLC2A4 regulator |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 56731 |
| Gene_Symbol: | SLC2A4RG |
| Omim_ID: | 609493, |
order or
more information: | company product webpage |
| request information: |
|