| CatalogCode: | | H00056660-A01 |
| ProductName: | | KCNK12 Antibody |
| Product Description: | | Mouse Polyclonal anti-KCNK12 |
| Clonality: | | Polyclonal |
| Immunogen: | | KCNK12 (NP_071338, 166 a.a. ~ 216 a.a) partial recombinant protein with GST tag. |
| Epitope: | | ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYH* ... |
| Specificity: | | KCNK12 - potassium channel, subfamily K, member 12 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-THIK-2 antibody, anti-THIK2 antibody |
| ProteinTarget: | | KCNK12 - potassium channel, subfamily K, member 12 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 56660 |
| Gene_Symbol: | | KCNK12 |
| Omim_ID: | | 607366, |
| more information: | | company product webpage |