ExactAntigen

SLC2A9 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00056606-A01
Product Type:Primary Antibody
Product Name:SLC2A9 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:56606
Host:Mouse
Product Description:Mouse Polyclonal anti-SLC2A9
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 56606 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-GLUT9 antibody, anti-GLUTX antibody
Immunogen:SLC2A9 (NP_001001290, 224 a.a. ~ 288 a.a) partial recombinant protein with GST tag.
Epitope:PDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQ* ...
Specificity:SLC2A9 - solute carrier family 2 (facilitated glucose transporter), member 9
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SLC2A9
Omim ID:606142,
see all human SLC2A9 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about