ExactAntigen

Mouse Polyclonal anti-PCDHA11 | Novus Biologicals antibody product information
CatalogCode:H00056138-A01
ProductName:PCDHA11 Antibody
Product Description:Mouse Polyclonal anti-PCDHA11
Clonality:Polyclonal
Immunogen:PCDHA11 (NP_061725, 203 a.a. ~ 292 a.a) partial recombinant protein with GST tag.
Epitope:EKTPELNLLLTATDGGKPELTGTVRLLVQVLDVNDNDPEFDKSEYKVSLMENAAKETLVLKLNATDRDEGVNGEVTYSLMSIKPNGRHL* ...
Specificity:PCDHA11 - protocadherin alpha 11
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-CNR7 antibody, anti-CNRN7 antibody, anti-CNRS7 antibody, anti-CRNR7 antibody, anti-PCDH-ALPHA11 antibody
ProteinTarget:PCDHA11 - protocadherin alpha 11
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:56138
Gene_Symbol:PCDHA11
Omim_ID:606317 H00056137-A01
order or
more information
:
company product webpage
request information:
Also see:
all human PCDHA11 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about