| Catalog Code: | H00055872-M17 |
| Product Type: | Primary Antibody |
| Product Name: | PBK Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 55872 |
| Host: | Mouse |
| Clone: | 2D2 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-PBK (2D2) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in |
| Alternate Names: | anti-FLJ14385 antibody, anti-Nori-3 antibody, anti-SPK antibody, anti-TOPK antibody |
| Immunogen: | PBK (NP_060962, 122 a.a. ~ 229 a.a) full length recombinant protein with GST tag. |
| Epitope: | SLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKAD* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PBK |