ExactAntigen

PBK Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00055872-M12
Product Type:Primary Antibody
Product Name:PBK Antibody
List Price:275
Clonality:Monoclonal
Gene ID:55872
Host:Mouse
Clone:1E11
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-PBK (1E11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in
Alternate Names:anti-FLJ14385 antibody, anti-Nori-3 antibody, anti-SPK antibody, anti-TOPK antibody
Immunogen:PBK (AAH15191, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Epitope:MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS ...
Specificity:PBK - PDZ binding kinase
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PBK
see all human PDZ binding kinase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about