| Catalog Code: | H00055872-M11 |
| Product Type: | Primary Antibody |
| Product Name: | PBK Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 55872 |
| Host: | Mouse |
| Clone: | 3A11 |
| Product Description: | Mouse Monoclonal anti-PBK (3A11) |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase m |
| Alternate Names: | anti-PDZ binding kinase antibody |
| Immunogen: | PBK (AAH15191, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS ... |
| Purity: | protein A purified |
| Buffer: | 1x PBS, pH 7.2 |
| Packaging: | 0.1 ml protein A purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody reactive against recombinant protein on ELISA. The antibody is also shown to be specific in Western blot against cell lysates and in immunohistochemistry on paraffin embedded sections. |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PBK |