ExactAntigen

Mouse Monoclonal anti-PBK (3A7)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00055872-M07
ProductName:PBK Antibody
Product Description:Mouse Monoclonal anti-PBK (3A7)
Clone:3A7
Clonality:Monoclonal
Immunogen:PBK (AAH15191, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Epitope:MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS ...
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background:This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:protein A purified
Host_Name:Mouse
Buffer:1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-PDZ binding kinase antibody
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:55872
Gene_Symbol:PBK
see all human PDZ binding kinase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about