ExactAntigen

Mouse Monoclonal anti-PBK (3F7) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00055872-M04
ProductName: PBK Antibody
Product Description: Mouse Monoclonal anti-PBK (3F7)
Clone: 3F7
Clonality: Monoclonal
Immunogen: PBK (AAH15191, 1 a.a. ~ 323 a.a) full length recombinant protein with GST tag.
Epitope: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDD ...
Specificity: PBK - PDZ binding kinase
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA. The antibody is also shown to be specific in Western blot against cell lysates.
Background: This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-FLJ14385 antibody, anti-Nori-3 antibody, anti-SPK antibody, anti-TOPK antibody
ProteinTarget: PBK - PDZ binding kinase
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 55872
Gene_Symbol: PBK
more information: company product webpage
Also see:
see all human PDZ binding kinase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about