ExactAntigen

septin 11 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00055752-M01
Product Type:Primary Antibody
Product Name:septin 11 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:55752
Host:Mouse
Clone:4G1
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-septin 11 (4G1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = SEPT11 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Immunogen:SEPT11 (AAH08083, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Epitope:LRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYID ...
Specificity:SEPT11 - septin 11
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SEPT11
see all human SEPT11 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about