ExactAntigen

Mouse Polyclonal anti-NAGK
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00055577-A01
ProductName:NAGK Antibody
Product Description:Mouse Polyclonal anti-NAGK
Clonality:Polyclonal
Immunogen:NAGK (NP_060037, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag.
Epitope:MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLR* ...
Specificity:NAGK - N-acetylglucosamine kinase
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera
Background:N-acetylglucosamine kinase (NAGK; EC 2.7.1.59) converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. NAGK belongs to the group of N-acetylhexosamine kinases and is a prominent salvage enzyme of amino sugar metabolism in mammals.[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-GNK antibody, anti-HSA242910 antibody
ProteinTarget:NAGK - N-acetylglucosamine kinase
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:55577
Gene_Symbol:NAGK
Omim_ID:606828 H00004669-A01
see all human N acetylglucosamine kinase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about