| CatalogCode: | H00055303-A01 |
| ProductName: | GIMAP4 Antibody |
| Product Description: | Mouse Polyclonal anti-GIMAP4 |
| Clonality: | Polyclonal |
| Immunogen: | GIMAP4 (NP_060796, 125 a.a. ~ 225 a.a) partial recombinant protein with GST tag. |
| Epitope: | RYTEEEHKATEKILKMFGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNR* ... |
| Specificity: | GIMAP4 - GTPase, IMAP family member 4 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia 1 (TAL1). In humans, the IAN subfamily genes are located in a cluster at 7q36.1. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-FLJ11110 antibody, anti-HIMAP4 antibody, anti-IAN1 antibody, anti-IMAP4 antibody, anti-MSTP062 antibody, anti-hIAN1 antibody |
| ProteinTarget: | GIMAP4 - GTPase, IMAP family member 4 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 55303 |
| Gene_Symbol: | GIMAP4 |
| Omim_ID: | 608087, |
order or
more information: | company product webpage |
| request information: |
|