| Catalog Code: | H00055294-M02 |
| Product Type: | Primary Antibody |
| Product Name: | FBXW7 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 55294 |
| Host: | Mouse |
| Clone: | 3D1 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-FBXW7 (3D1) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = FBXW7 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-AGO antibody, anti-CDC4 antibody, anti-DKFZp686F23254 antibody, anti-FBW7 antibody, anti-FBX30 antibody, anti-FBXW6 antibody, anti-SEL-10 antibody, anti-SEL10 antibody |
| Immunogen: | FBXW7 (NP_361014, 599 a.a. ~ 708 a.a) partial recombinant protein with GST tag. |
| Epitope: | ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK* ... |
| Specificity: | FBXW7 - F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila) |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections. |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | FBXW7 |
| Omim ID: | 606278, |