| CatalogCode: | | H00055294-A01 |
| ProductName: | | FBXW7 Antibody |
| Product Description: | | Mouse Polyclonal anti-FBXW7 |
| Clonality: | | Polyclonal |
| Immunogen: | | FBXW7 (NP_361014, 599 a.a. ~ 708 a.a) partial recombinant protein with GST tag. |
| Epitope: | | ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK* ... |
| Specificity: | | FBXW7 - F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Three transcript variants encoding three different isoforms have been found for this gene. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-AGO antibody, anti-CDC4 antibody, anti-DKFZp686F23254 antibody, anti-FBW7 antibody, anti-FBX30 antibody, anti-FBXW6 antibody, anti-SEL-10 antibody, anti-SEL10 antibody |
| ProteinTarget: | | FBXW7 - F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 55294 |
| Gene_Symbol: | | FBXW7 |
| Omim_ID: | | 606278 H00055294-M02 |
| more information: | | company product webpage |