ExactAntigen

WDR41 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00055255-M01
Product Type:Primary Antibody
Product Name:WDR41 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:55255
Host:Mouse
Clone:1F3
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-WDR41 (1F3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = WDR41 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-FLJ10904 antibody, anti-MSTP048 antibody
Immunogen:WDR41 (AAH40241, 1 a.a. ~ 460 a.a) full length recombinant protein with GST tag.
Epitope:MLRWLIGGGREPQGLAEKSPLQTIGEEQTQNPYTELLVLKAHHDIVRFLVQLDDYRFASAGDDGIVVVWNAQTGEKLLELNGHTQKITAIITFPSLESCEEKNQLILTASADRTVIVWDGDTTRQVQRISCFQSTVKCLTVLQRLDVWLSGGNDLCVWNRKLDLLCKTSHLSDTGISALVEIPKNCVVAAVGKELIIFRLVAPTEGSLEWDILEVKRLLDHQDNILSLINVNDLSFVTGSHVGELIIWDALDWTM ...
Specificity:WDR41 - WD repeat domain 41
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:WDR41
see all human WDR41 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about