ExactAntigen

Mouse Polyclonal anti-FLJ10808 | Novus Biologicals antibody product information
CatalogCode:H00055236-A01
ProductName:FLJ10808 Antibody
Product Description:Mouse Polyclonal anti-FLJ10808
Clonality:Polyclonal
Immunogen:FLJ10808 (NP_060697, 962 a.a. ~ 1052 a.a) partial recombinant protein with GST tag.
Epitope:GKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHDT* ...
Specificity:FLJ10808 - hypothetical protein FLJ10808
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ProteinTarget:FLJ10808 - hypothetical protein FLJ10808
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:55236
Gene_Symbol:FLJ10808
order or
more information
:
company product webpage
request information:
Also see:
all human UBA6 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about