| Catalog Code: | H00055215-B01 |
| Product Type: | Primary Antibody |
| Product Name: | KIAA1794 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 55215 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-KIAA1794 - KIAA1794, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN |
| Alternate Names: | anti-FLJ10719 antibody |
| Immunogen: | KIAA1794 (AAH04277, 1 a.a. ~ 74 a.a) full-length human protein. |
| Epitope: | MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE* ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|