ExactAntigen

KIAA1794 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00055215-B01
Product Type:Primary Antibody
Product Name:KIAA1794 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:55215
Host:Mouse
Product Description:Mouse Polyclonal anti-KIAA1794 - KIAA1794, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Alternate Names:anti-FLJ10719 antibody
Immunogen:KIAA1794 (AAH04277, 1 a.a. ~ 74 a.a) full-length human protein.
Epitope:MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE* ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human FANCI antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about