ExactAntigen

Mouse Polyclonal anti-TRIM68
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00055128-A01
ProductName:TRIM68 Antibody
Product Description:Mouse Polyclonal anti-TRIM68
Clonality:Polyclonal
Immunogen:TRIM68 (NP_060543, 181 a.a. ~ 281 a.a) partial recombinant protein with GST tag.
Epitope:KQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQKLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEP* ...
Specificity:TRIM68 - tripartite motif-containing 68
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is expressed in many cancer cell lines. Its expression in normal tissues, however, was found to be restricted to prostate. This gene was also found to be differentially expressed in androgen-dependent versus androgen-independent prostate cancer cells.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-FLJ10369 antibody, anti-RNF137 antibody, anti-SS-56 antibody
ProteinTarget:TRIM68 - tripartite motif-containing 68
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:55128
Gene_Symbol:TRIM68
see all human SS 56 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about