ExactAntigen

Mouse Monoclonal anti-WIPI1 (3C1) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00055062-M02
ProductName: WIPI1 Antibody
Product Description: Mouse Monoclonal anti-WIPI1 (3C1)
Clone: 3C1
Clonality: Monoclonal
Immunogen: WIPI1 (NP_060453, 348 a.a. ~ 446 a.a) partial recombinant protein with GST tag.
Epitope: GGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQ* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM]
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2b Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-Atg18 antibody, anti-FLJ10055 antibody, anti-WIPI49 antibody
ProteinTarget: WD repeat domain, phosphoinositide interacting 1
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 55062
Gene_Symbol: WIPI1
Omim_ID: 609224,
more information: company product webpage
Also see:
see all human WIPI49 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about