ExactAntigen

OCIAD1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00054940-B01
Product Type:Primary Antibody
Product Name:OCIAD1 Antibody
List Price:275
Clonality:Polyclonal
Gene ID:54940
Host:Mouse
Clone:OCIA domain containing 1
Product Description:Mouse Polyclonal anti-OCIAD1 - OCIA domain containing 1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Alternate Names:anti-Asrij antibody, anti-FLJ20455 antibody, anti-MGC111072 antibody, anti-OCIA antibody, anti-TPA018 antibody
Immunogen:OCIAD1 (AAH03409, 1 a.a. ~ 246 a.a) full-length human protein.
Epitope:MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE* ...
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:OCIAD1
see all human OCIAD1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about