ExactAntigen

Mouse Monoclonal anti-TEB1 (1E1) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00054937-M04
ProductName: TEB1 Antibody
Product Description: Mouse Monoclonal anti-TEB1 (1E1)
Clone: 1E1
Clonality: Monoclonal
Immunogen: TEB1 (AAH25383, 1 a.a. ~ 226 a.a) full length recombinant protein with GST tag.
Epitope: MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA
SpeciesSummary: Hu
ALTnames: anti-FLJ20449 antibody, anti-bA121N13.2 antibody
ProteinTarget: hypothetical protein FLJ20449
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 54937
Gene_Symbol: TEB1
more information: company product webpage
Also see:
see all human SOHLH2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about