ExactAntigen

Mouse Monoclonal anti-DDX56 (4C5) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00054606-M05
ProductName: DDX56 Antibody
Product Description: Mouse Monoclonal anti-DDX56 (4C5)
Clone: 4C5
Clonality: Monoclonal
Immunogen: DDX56 (NP_061955, 450 a.a. ~ 548 a.a) partial recombinant protein with GST tag.
Epitope: IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS* ...
Specificity: DDX56 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background: This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene shows ATPase activity in the presence of polynucleotides and associates with nucleoplasmic 65S preribosomal particles. This gene may be involved in ribosome synthesis, most likely during assembly of the large 60S ribosomal subunit.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB, IHC-P
SpeciesSummary: Hu
ALTnames: anti-DDX21 antibody, anti-NOH61 antibody
ProteinTarget: DDX56 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 54606
Gene_Symbol: DDX56
Omim_ID: 608023,
more information: company product webpage
Also see:
see all human NOH61 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about