| request information: |
|
| Catalog Code: | H00054567-A01 |
| Product Name: | delta-like 4 Antibody |
| Product Description: | Mouse Polyclonal anti-delta-like 4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 54567 |
| Gene Symbol: | DLL4 |
| Omim ID: | 605185, |
| Immunogen: | DLL4 (NP_061947, 123 a.a. ~ 222 a.a) partial recombinant protein with GST tag. |
| Epitope: | HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQ
PDGNLSCLPGWTGEYCQQPI* |
| Specificity: | delta-like 4 (Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Mouse antisera. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC126344 antibody, anti-hdelta2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |