| request information: |
|
| Catalog Code: | H00054496-A01 |
| Product Name: | PRMT7 Antibody |
| Product Description: | Mouse Polyclonal anti-PRMT7 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 54496 |
| Gene Symbol: | PRMT7 |
| Immunogen: | PRMT7 (NP_061896, 88 a.a. ~ 198 a.a) partial recombinant protein with GST tag. |
| Epitope: | DFCYAIEVFKPMADAAVKIVEKNGFSDKIKVINKHSTEVTVGPEGDMPCRANILVTELFDTELIGEGALPSYEHAHRHL
VEENCEAVPHRATVYAQLVESGRMWSWNKLF* |
| Specificity: | PRMT7 - protein arginine N-methyltransferase 7 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing (Miranda et al., 2004 [PubMed 15044439]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ10640 antibody, anti-KIAA1933 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |