| request information: |
|
| Catalog Code: | H00054455-A01 |
| Product Name: | FBXO42 Antibody |
| Product Description: | Mouse Polyclonal anti-FBXO42 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 54455 |
| Gene Symbol: | FBXO42 |
| Omim ID: | 609109, |
| Immunogen: | FBXO42 (NP_061867, 619 a.a. ~ 718 a.a) partial recombinant protein with GST tag. |
| Epitope: | RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDK
KQNVKYYPKTNALYFVRAKR* |
| Specificity: | FBXO42 - F-box protein 42 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Fbx42 antibody, anti-KIAA1332 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |