| request information: |
|
| Catalog Code: | H00054431-M01 |
| Product Name: | DNAJC10 Antibody |
| Product Description: | Mouse Monoclonal anti-DNAJC10 (3C4) |
| Clone: | 3C4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 54431 |
| Gene Symbol: | DNAJC10 |
| Omim ID: | 607987, |
| Immunogen: | DNAJC10 (NP_061854, 688 a.a. ~ 794 a.a) partial recombinant protein with GST tag. |
| Epitope: | KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTR
DAKAIAALISEKLETLRNQGKRNKDEL* |
| Specificity: | DNAJC10 - DnaJ (Hsp40) homolog, subfamily C, member 10 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-DKFZp434J1813 antibody, anti-ERdj5 antibody, anti-JPDI antibody, anti-MGC104194 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |